Flightless I Monoclonal antibody

Flightless I Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67039-1-Ig
Clone No.2F9C8

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, IHC, ELISA

FLI, Fli1, Flightless I, FLII, FLIL, Protein flightless 1 homolog

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, A549 cells, NCI-H1299 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells, HepG2 cells, MCF-7 cells, NCCIT cells, HT-1080 cells, LNCaP cells
Positive IHC detected inhuman colon cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

67039-1-Ig targets Flightless I in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26865

Product name: Recombinant human FLII protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 440-900 aa of BC025300

Sequence: DQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW

Predict reactive species
Full Name flightless I homolog (Drosophila)
Calculated Molecular Weight 1269 aa, 145 kDa
Observed Molecular Weight 145-150 kDa
GenBank Accession NumberBC025300
Gene Symbol Flightless I
Gene ID (NCBI) 2314
RRIDAB_2882353
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13045
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Flightless I (FliI) is the most evolutionarily conserved member of the gelsolin superfamily of proteins which are key regulators of actin filament assembly and turnover. FliI comprises an N-terminal leucine-rich repeat (LRR) domain which is not present in other gelsolin family members, and the LRR domain may enable interactions between FliI and other molecules involved in signal transduction, thereby spatially integrating signaling and actin remodeling functions. This protein was originally found in Drosophila and participates in the embryonic development, while mammalian FliI protein was involved in the regulation of wound repair,skin barrier development. Studies recently demonstrated that FliI protein associated with colorectal cancer, hepatocellular and prostate cancer (PMID:30091651; 28498392).

Protocols

Product Specific Protocols
WB protocol for Flightless I antibody 67039-1-IgDownload protocol
IHC protocol for Flightless I antibody 67039-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Genes Dev

Localization of Kif1c mRNA to cell protrusions dictates binding partner specificity of the encoded protein

Authors - Megan L Norris
humanWB

Am J Cancer Res

SH3BGRL2 exerts a dual function in breast cancer growth and metastasis and is regulated by TGF-β1.

Authors - Dou-Dou Li
Loading...
||
New chat Able
正在加载,请稍候...