Frizzled 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Frizzled 2 Polyclonal antibody, PBS Only (24272-1-PBS)

• 

  WB analysis using 24272-1-AP (same clone as 24272-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24272-1-AP (Frizzled 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24272-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse colon using 24272-1-AP (same clone as 24272-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 24272-1-AP (Frizzled 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24272-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24272-1-AP (same clone as 24272-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24272-1-AP (Frizzled 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24272-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 24272-1-AP (same clone as 24272-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 24272-1-AP (Frizzled 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 24272-1-AP (same clone as 24272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 24272-1-AP (Frizzled 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24272-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 24272-1-AP (same clone as 24272-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 24272-1-AP (Frizzled 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24272-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Frizzled 2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24272-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

FZD2, Frizzled-2, Fz 2, Fz-2, FzE2

---

Product Information

24272-1-PBS targets Frizzled 2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18003

  Product name: Recombinant human FZD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-217 aa of BC113402

  Sequence: CEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLG

• Full Name: frizzled homolog 2 (Drosophila)
• Calculated Molecular Weight: 565 aa, 64 kDa
• Observed Molecular Weight: 64-70 kDa
• GenBank Accession Number: BC113402
• Gene Symbol: Frizzled 2
• Gene ID (NCBI): 2535
• RRID: AB_2879463
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14332
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Frizzled 2(FZD2) also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. FZD2 is an important receptor in the Wnt pathway, which is highly expressed in malignant tumors and helps regulate multiple tumor behaviors. Its expression level is related to prognosis. Moreover, high level of FZD2 had significant correlation with poor prognosis in Breast cancer (BC) patients(PMID: 33832493).