Use Able AI chat for product recommendations

Frizzled 4 Recombinant monoclonal antibody, PBS Only

Frizzled 4 Uni-rAb® Recombinant Antibody for WB, IF-P, Indirect ELISA

Cat No. 87975-1-PBS
Clone No.260031F12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, Indirect ELISA

Frizzled-4, FZD4, CD344, EVR1, FEVR

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87975-1-PBS targets Frizzled 4 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg5015

Product name: Recombinant human FZD4 protein

Source: mammalian cells-derived, pHZ-KIsec-C-mFc

Tag: C-mFc

Domain: 37-180 aa of BC114527

Sequence: FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

Predict reactive species
Full Name frizzled homolog 4 (Drosophila)
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC114527
Gene Symbol FZD4
Gene ID (NCBI) 8322
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9ULV1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Frizzled 4, officially known as frizzled class receptor 4 and designated FZD4, is a protein encoded by the FZD4 gene in humans. It is a member of the frizzled (Fz) gene family, which encodes seven-transmembrane domain proteins that primarily function as receptors for Wnt signaling proteins. Frizzled 4 is embedded in the outer membrane of many cell types, where it plays a critical role in transmitting chemical signals from outside the cell to the nucleus. Frizzled 4 has an almost ubiquitous expression pattern and is found in a wide range of human tissues. Mutations in the FZD4 gene are linked to familial exudative vitreoretinopathy (EVR1), an eye disorder that affects the retina and can lead to progressive vision loss.

Loading...
||
New chat

Able

正在加载,请稍候...