Frizzled 5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Frizzled 5 Polyclonal antibody, PBS Only (21519-1-PBS)

• 

  WB analysis using 21519-1-AP (same clone as 21519-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21519-1-AP (Frizzled 5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21519-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21519-1-AP (same clone as 21519-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21519-1-AP (Frizzled 5 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 21519-1-AP (same clone as 21519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21519-1-AP (Frizzled 5 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 21519-1-AP (same clone as 21519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 21519-1-AP (FZD5 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 21519-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 21519-1-AP (same clone as 21519-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 21519-1-AP (FZD5 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 21519-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21519-1-AP (same clone as 21519-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using Frizzled 5 antibody (21519-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21519-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21519-1-AP (same clone as 21519-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using Frizzled 5 antibody (21519-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21519-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Frizzled 5 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 21519-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FZD5, FzE5, Fz-5, Fz 5, Frizzled-5

---

Product Information

21519-1-PBS targets Frizzled 5 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16082

  Product name: Recombinant human FZD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 524-585 aa of BC114346

  Sequence: GKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV

• Full Name: frizzled homolog 5 (Drosophila)
• Calculated Molecular Weight: 585 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC114346
• Gene Symbol: FZD5
• Gene ID (NCBI): 7855
• RRID: AB_2878877
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13467
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fzd5, is the receptor for the Wnt5A ligand. Fzd5 modulates cell fate and cell behavior during vertebrate development. It regulates hematopoiesis by the antagonism of the canonical Wnt pathway, resulting in a pool of quiescent hematopoietic stem cells, and regulates hematopoietic stem cell function in a paracrine fashion through several distinct mechanisms including modulating canonical Wnt signaling. It acts through noncanonical Wnt signaling to promote angiogenesis. It is also involved in control cell orientation, polarity, and directional movement in response to positional cues from chemokine gradients.