Frizzled 7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Frizzled 7 Polyclonal antibody, PBS Only (16974-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 16974-1-AP (same clone as 16974-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16974-1-AP (Frizzled 7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 16974-1-AP (same clone as 16974-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16974-1-AP (Frizzled 7 antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16974-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 16974-1-AP (same clone as 16974-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16974-1-AP (Frizzled 7 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16974-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse skeletal muscle using 16974-1-AP (same clone as 16974-1-PBS)

  IP result of anti-Frizzled 7 (IP:16974-1-AP, 4ug; Detection:16974-1-AP 1:600) with mouse skeletal muscle tissue lysate 2200ug. This data was developed using the same antibody clone with 16974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 16974-1-AP (same clone as 16974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 16974-1-AP (Frizzled 7 antibody) at dilution of 1:800 (under 10x lens). This data was developed using the same antibody clone with 16974-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 16974-1-AP (same clone as 16974-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 16974-1-AP (Frizzled 7 antibody) at dilution of 1:800 (under 40x lens). This data was developed using the same antibody clone with 16974-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Frizzled 7 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 16974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

16974-1-PBS targets Frizzled 7 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9446

  Product name: Recombinant human FZD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 33-257 aa of BC015915

  Sequence: QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWV

• Full Name: frizzled homolog 7 (Drosophila)
• Calculated Molecular Weight: 574 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC015915
• Gene Symbol: Frizzled 7
• Gene ID (NCBI): 8324
• RRID: AB_2294535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75084
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Frizzled class receptor 7 (Frizzled 7, also known as FZD7) is a member of the superfamily of G protein-coupled receptor proteins that act as receptors in the Wnt signaling pathway. Frizzled 7 plays a role in development, stem cell renewal, and differentiation and has been implicated in the progression of various cancers.

What is the molecular weight of Frizzled 7? Is Frizzled 7 post-translationally modified?

The molecular size of Frizzled 7 is ~63 kDa, which represents the mature N-glycosylated species (PMID: 25274627). Frizzled 7 can form homodimers and heterodimers with other Frizzled family members (PMID: 14688793).

What is the subcellular localization of Frizzled 7?

Frizzled 7 is a seven-pass transmembrane protein that is present at the plasma membrane. In endothelial cells, it predominantly locates to cell-cell junctions (PMID: 24866384). Frizzled 7 has a cleavage site for calpain-1 protease in its C-terminus that regulates its activity and plasma membrane turnover (PMID: 17716656).

What is the tissue expression pattern of Frizzled 7?

Frizzled 7 is expressed at high levels in adult skeletal muscles and in fetal kidneys, but is also present in fetal lung, adult heart, brain, and placenta (PMID: 9813155). Frizzled 7 expression is increased in various cancer types, including melanoma, hepatocellular carcinoma, lung, esophageal, gastric, and colon cancers.