Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Frizzled 7 Polyclonal antibody, PBS Only

Frizzled 7 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 16974-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

16974-1-PBS targets Frizzled 7 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9446

Product name: Recombinant human FZD7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 33-257 aa of BC015915

Sequence: QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWV

Predict reactive species
Full Name frizzled homolog 7 (Drosophila)
Calculated Molecular Weight 574 aa, 64 kDa
Observed Molecular Weight 64 kDa
GenBank Accession NumberBC015915
Gene Symbol Frizzled 7
Gene ID (NCBI) 8324
RRIDAB_2294535
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75084
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Frizzled class receptor 7 (Frizzled 7, also known as FZD7) is a member of the superfamily of G protein-coupled receptor proteins that act as receptors in the Wnt signaling pathway. Frizzled 7 plays a role in development, stem cell renewal, and differentiation and has been implicated in the progression of various cancers.

What is the molecular weight of Frizzled 7? Is Frizzled 7 post-translationally modified?

The molecular size of Frizzled 7 is ~63 kDa, which represents the mature N-glycosylated species (PMID: 25274627). Frizzled 7 can form homodimers and heterodimers with other Frizzled family members (PMID: 14688793).

What is the subcellular localization of Frizzled 7?

Frizzled 7 is a seven-pass transmembrane protein that is present at the plasma membrane. In endothelial cells, it predominantly locates to cell-cell junctions (PMID: 24866384). Frizzled 7 has a cleavage site for calpain-1 protease in its C-terminus that regulates its activity and plasma membrane turnover (PMID: 17716656).

What is the tissue expression pattern of Frizzled 7?

Frizzled 7 is expressed at high levels in adult skeletal muscles and in fetal kidneys, but is also present in fetal lung, adult heart, brain, and placenta (PMID: 9813155). Frizzled 7 expression is increased in various cancer types, including melanoma, hepatocellular carcinoma, lung, esophageal, gastric, and colon cancers.


Loading...
||
New chat

Able

正在加载,请稍候...