Tested Applications
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U-251 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
34058-1-AP targets G2E3 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40477 Product name: Recombinant human G2E3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 231-340 aa of BC000973 Sequence: ERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGEFQKAKKHVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGS Predict reactive species |
| Full Name | G2/M-phase specific E3 ubiquitin ligase |
| Calculated Molecular Weight | 706 aa, 81 kDa |
| Observed Molecular Weight | 80 kDa |
| GenBank Accession Number | BC000973 |
| Gene Symbol | G2E3 |
| Gene ID (NCBI) | 55632 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q7L622 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
G2/M-phase specific E3 ubiquitin protein ligase (G2E3) is a cell cycle-regulated E3 ubiquitin ligase that plays a critical role in controlling the G2/M transition. It functions by targeting specific substrates for proteasomal degradation during late G2 and M phases, thereby ensuring proper cell cycle progression. G2E3 contains a RING finger domain, characteristic of E3 ubiquitin ligases, and its expression is tightly regulated in a cell cycle-dependent manner, peaking during G2/M phases. Research has implicated G2E3 in various cellular processes, including DNA damage response and mitotic regulation (PMID: 17239372; PMID: 18511420; PMID: 41068090).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for G2E3 antibody 34058-1-AP | Download protocol |
| IHC protocol for G2E3 antibody 34058-1-AP | Download protocol |
| IP protocol for G2E3 antibody 34058-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







