G2E3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• G2E3 Polyclonal antibody (34058-1-AP)

• 

  IP experiment of mouse brain using 34058-1-AP

  IP result of anti-G2E3 (IP:34058-1-AP, 4ug; Detection:34058-1-AP 1:500) with mouse brain tissue lysate 1960 ug.

• 

  IHC staining of human kidney using 34058-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 34058-1-AP (G2E3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 34058-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 34058-1-AP (G2E3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

G2E3 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 34058-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IP, ELISA

Synonyms

KIAA1333, PHF7B

---

Tested Applications

• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34058-1-AP targets G2E3 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40477

  Product name: Recombinant human G2E3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 231-340 aa of BC000973

  Sequence: ERCDVRRCRCKEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGEFQKAKKHVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGS

• Full Name: G2/M-phase specific E3 ubiquitin ligase
• Calculated Molecular Weight: 706 aa, 81 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC000973
• Gene Symbol: G2E3
• Gene ID (NCBI): 55632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7L622
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

G2/M-phase specific E3 ubiquitin protein ligase (G2E3) is a cell cycle-regulated E3 ubiquitin ligase that plays a critical role in controlling the G2/M transition. It functions by targeting specific substrates for proteasomal degradation during late G2 and M phases, thereby ensuring proper cell cycle progression. G2E3 contains a RING finger domain, characteristic of E3 ubiquitin ligases, and its expression is tightly regulated in a cell cycle-dependent manner, peaking during G2/M phases. Research has implicated G2E3 in various cellular processes, including DNA damage response and mitotic regulation (PMID: 17239372; PMID: 18511420; PMID: 41068090).