G3BP1 Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 80777-1-RR (same clone as 80777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 80777-1-RR (G3BP1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80777-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 80777-1-RR (same clone as 80777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 80777-1-RR (G3BP1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80777-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 80777-1-RR (same clone as 80777-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using G3BP1 antibody (80777-1-RR, Clone: 7F14 ) at dilution of 1:500 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80777-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 80777-1-RR (same clone as 80777-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed sodium arsenite treated HeLa cells using G3BP1 antibody (80777-1-RR, Clone: 7F14 ) at dilution of 1:1400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 80777-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80777-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80777-1-RR against Human G3BP1 were performed. The affinity constant is 7.07 nM.

G3BP1 Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 80777-1-PBS

Clone No.7F14

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

7F14, ATP-dependent DNA helicase VIII, EC:3.6.4.12, G3BP, G3BP 1

---

Product Information

80777-1-PBS targets G3BP1 in IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3728

  Product name: Recombinant human G3BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 167-466 aa of BC006997

  Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ

• Full Name: GTPase activating protein (SH3 domain) binding protein 1
• Calculated Molecular Weight: 466 aa, 52 kDa
• GenBank Accession Number: BC006997
• Gene Symbol: G3BP1
• Gene ID (NCBI): 10146
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13283
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.