Use Able AI chat for product recommendations

MPIG6B Recombinant monoclonal antibody, PBS Only (Capture)

MPIG6B Uni-rAb® Recombinant Antibody for WB, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 88167-2-PBS
Clone No.260393F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

C6orf25, G6B, G6B-B, Megakaryocyte and platelet inhibitory receptor G6b, NG31

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

88167-2-PBS targets MPIG6B as part of a matched antibody pair:

MP03352-1: 88167-2-PBS capture and 88167-1-PBS detection (validated in Cytometric bead array)

MP03352-2: 88167-2-PBS capture and 88167-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg5762

Product name: Recombinant human G6B protein

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 18-142 aa of NM_138272.3

Sequence: NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

Predict reactive species
Full Name chromosome 6 open reading frame 25
Calculated Molecular Weight26 kDa
Observed Molecular Weight17kDa, 26 kDa
GenBank Accession NumberNM_138272.3
Gene Symbol C6orf25
Gene ID (NCBI) 80739
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95866-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MPIG6B (Megakaryocyte and Platelet Inhibitory Receptor G6b), also known as G6b-B or C6orf25, is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily, and serves as a key negative regulatory receptor for platelet activation and megakaryocyte differentiation. The intracellular domain of MPIG6B contains immunoreceptor tyrosine-based inhibitory motifs (ITIMs), which recruit SHP-1/SHP-2 phosphatases to inhibit Src family kinase activity, thereby negatively regulating platelet aggregation, release reactions, and megakaryocyte maturation. Mutations in the MPIG6B gene lead to thrombocytopenia and bleeding tendency, and its functional dysregulation is associated with immune thrombocytopenia (ITP) and myeloproliferative neoplasms.

Loading...
||
New chat

Able

正在加载,请稍候...