G6PC2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• G6PC2 Polyclonal antibody, PBS Only (18074-1-PBS)

• 

  IP experiment of mouse pancreas using 18074-1-AP (same clone as 18074-1-PBS)

  IP result of anti-G6PC2 (IP:18074-1-AP, 4ug; Detection:18074-1-AP 1:500) with mouse pancreas tissue lysate 2480 ug. This data was developed using the same antibody clone with 18074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 18074-1-AP (same clone as 18074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 18074-1-AP (G6PC2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 18074-1-AP (same clone as 18074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 18074-1-AP (G6PC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18074-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse pancreas using 18074-1-AP (same clone as 18074-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse pancreas tissue using G6PC2 antibody (18074-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18074-1-PBS in a different storage buffer formulation.

G6PC2 Polyclonal Antibody for IHC, IF-P, IP, Indirect ELISA

Cat No. 18074-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, IP, Indirect ELISA

Synonyms

G6Pase 2, IGRP

---

Product Information

18074-1-PBS targets G6PC2 in IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12764

  Product name: Recombinant human G6PC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC104778

  Sequence: MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDKFSITLHRLTWS

• Full Name: glucose-6-phosphatase, catalytic, 2
• Calculated Molecular Weight: 355 aa, 41 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC104778
• Gene Symbol: G6PC2
• Gene ID (NCBI): 57818
• RRID: AB_3741945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQR9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

G6PC2, also known as IGRP, is a member of the glucose-6-phosphatase catalytic subunit (G6PC) gene family. G6PC2 catalyzes the hydrolysis of glucose-6-phosphate to glucose and inorganic phosphate within the lumen of the endoplasmic reticulum. G6PC2 is mainly expressed in pancreatic islet β-cells. G6PC2 acts to oppose the action of the beta cell glucose sensor, glucokinase, by creating a futile substrate cycle. (PMID: 37855366, PMID: 32569842, PMID: 37552875)