Filter: AllIHC

IHC staining of human placenta using 30642-1-AP (same clone as 30642-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30642-1-AP (GABRP antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30642-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 30642-1-AP (same clone as 30642-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 30642-1-AP (GABRP antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30642-1-PBS in a different storage buffer formulation.

GABRP Polyclonal antibody, PBS Only

Name: GABRP Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30642-1-PBS

GABRP Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 30642-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

GABA A receptor pi, GABA(A) receptor subunit pi, GABAA receptor pi, GABAAR subunit pi, Gamma-aminobutyric acid receptor subunit pi

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

30642-1-PBS targets GABRP in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag32653 Product name: Recombinant human GABRP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 328-416 aa of BC074865 Sequence: HYSSLQQMAAKDRGTTKEVEEVSITNIINSSISSFKRKISFASIEISSDNVDYSDLTMKTSDKFKFVFREKMGRIVDYFTIQNPSNVDH Predict reactive species
Full Name	gamma-aminobutyric acid (GABA) A receptor, pi
Calculated Molecular Weight	440 aa, 51 kDa
Observed Molecular Weight	51 kDa
GenBank Accession Number	BC074865
Gene Symbol	GABRP
Gene ID (NCBI)	2568
RRID	AB_3742362
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O00591
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™