GADD34 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 81250-1-RR (same clone as 81250-1-PBS)

  MG132 treated HeLa cells were subjected to SDS PAGE followed by western blot with 81250-1-RR (GADD34 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 81250-1-RR (same clone as 81250-1-PBS)

  MG132 treated HepG2 cells were subjected to SDS PAGE followed by western blot with 81250-1-RR (GADD34 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 81250-1-RR (same clone as 81250-1-PBS)

  MG132 treated NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 81250-1-RR (GADD34 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 81250-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 81250-1-RR (same clone as 81250-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using GADD34 antibody (81250-1-RR, Clone: 4K3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 81250-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 81250-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81250-1-RR against Human GADD34 were performed. The affinity constant is 93.8 pM.

GADD34 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 81250-1-PBS

Clone No.4K3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PPP1R15A, Growth arrest and DNA damage-inducible protein GADD34, growth arrest and DNA damage-inducible protein 34, 4K3

---

Product Information

81250-1-PBS targets GADD34 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0578

  Product name: Recombinant human GADD34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 307-572 aa of BC003067

  Sequence: SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 15A
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC003067
• Gene Symbol: GADD34
• Gene ID (NCBI): 23645
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75807
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GADD34, also named PPP1R15A, belongs to the PPP1R15 family. GADD34 can be triggered as a direct target of activating transcription factor4 (ATF4) under ER stress, it plays a pivotal role in the recovery of cells from shut-down of translation induced by ER stress. It recruits the serine/threonine-protein phosphatase (PP1) to dephosphorylate the translation initiation factor eIF2alpha, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress. GADD34 down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 via PP1. It may also promote apoptosis by inducing TP53 phosphorylation on 'Ser-15'. Starvation-induced expression of GADD34 reduced mTOR activity and induced autophagy in wild-type mice, but not in GADD34 KO mice. Molecular weight of GADD34 is 100 kDa confirmed in GADD34 KO mice, and Proteintech's GADD34 antibody 81250-1-RR primarily recongizes the 100 kDa band.