GADD34 Recombinant monoclonal antibody

GADD34 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 81250-1-RR
Clone No.4K3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

PPP1R15A, 4K3, growth arrest and DNA damage-inducible protein 34, Growth arrest and DNA damage-inducible protein GADD34

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMG132 treated HepG2 cells, MG132 treated NIH/3T3 cells, MG132 treated HeLa cells
Positive IHC detected inmouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81250-1-RR targets GADD34 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0578

Product name: Recombinant human GADD34 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 307-572 aa of BC003067

Sequence: SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG

Predict reactive species
Full Name protein phosphatase 1, regulatory (inhibitor) subunit 15A
Calculated Molecular Weight 73 kDa
Observed Molecular Weight100 kDa
GenBank Accession NumberBC003067
Gene Symbol GADD34
Gene ID (NCBI) 23645
RRIDAB_2923712
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75807
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GADD34, also named PPP1R15A, belongs to the PPP1R15 family. GADD34 can be triggered as a direct target of activating transcription factor4 (ATF4) under ER stress, it plays a pivotal role in the recovery of cells from shut-down of translation induced by ER stress. It recruits the serine/threonine-protein phosphatase (PP1) to dephosphorylate the translation initiation factor eIF2alpha, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress. GADD34 down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 via PP1. It may also promote apoptosis by inducing TP53 phosphorylation on 'Ser-15'. Starvation-induced expression of GADD34 reduced mTOR activity and induced autophagy in wild-type mice, but not in GADD34 KO mice. Molecular weight of GADD34 is 100 kDa confirmed in GADD34 KO mice, and Proteintech's GADD34 antibody 81250-1-RR primarily recongizes the 100 kDa band.

Protocols

Product Specific Protocols
IF protocol for GADD34 antibody 81250-1-RRDownload protocol
IHC protocol for GADD34 antibody 81250-1-RRDownload protocol
WB protocol for GADD34 antibody 81250-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Genes Dev

Ribosome association inhibits stress-induced gene mRNA localization to stress granules

Authors - Noah S Helton
Loading...
||
New chat

Able

正在加载,请稍候...