CoraLite® Plus 488-conjugated GADD34 Recombinant monoclonal antibody

• 

  IF Staining of PC-3 using CL488-81250

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using CoraLite® Plus 488 GADD34 antibody (CL488-81250, Clone: 4K3 ) at dilution of 1:200.

GADD34 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-81250

Clone No.4K3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

PPP1R15A, growth arrest and DNA damage-inducible protein 34, Growth arrest and DNA damage-inducible protein GADD34

---

Tested Applications

• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81250 targets GADD34 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0578

  Product name: Recombinant human GADD34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 307-572 aa of BC003067

  Sequence: SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 15A
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC003067
• Gene Symbol: GADD34
• Gene ID (NCBI): 23645
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75807
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GADD34, also named PPP1R15A, belongs to the PPP1R15 family. GADD34 can be triggered as a direct target of activating transcription factor4 (ATF4) under ER stress, it plays a pivotal role in the recovery of cells from shut-down of translation induced by ER stress. It recruits the serine/threonine-protein phosphatase (PP1) to dephosphorylate the translation initiation factor eIF2alpha, thereby reversing the shut-off of protein synthesis initiated by stress-inducible kinases and facilitating recovery of cells from stress. GADD34 down-regulates the TGF-beta signaling pathway by promoting dephosphorylation of TGFB1 via PP1. It may also promote apoptosis by inducing TP53 phosphorylation on 'Ser-15'. Starvation-induced expression of GADD34 reduced mTOR activity and induced autophagy in wild-type mice, but not in GADD34 KO mice. Molecular weight of GADD34 is 100 kDa confirmed in GADD34 KO mice, and Proteintech's GADD34 antibody 81250-1-RR primarily recongizes the 100 kDa band.