GALM Polyclonal antibody

• 

  WB analysis using 16022-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16022-1-AP (GALM antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16022-1-AP (GALM antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16022-1-AP (GALM antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse spleen using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 16022-1-AP (GALM antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 16022-1-AP (GALM antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16022-1-AP (GALM antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 16022-1-AP (GALM antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16022-1-AP (GALM antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 16022-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 16022-1-AP (GALM antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

GALM Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16022-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Aldose 1 epimerase, BLOCK25, Galactose mutarotase, GALM, IBD1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IHC detected in: human heart tissue, human brain tissue, human spleen tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

16022-1-AP targets GALM in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8842

  Product name: Recombinant human GALM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-342 aa of BC019263

  Sequence: MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

• Full Name: galactose mutarotase (aldose 1-epimerase)
• Calculated Molecular Weight: 342 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC019263
• Gene Symbol: GALM
• Gene ID (NCBI): 130589
• RRID: AB_2108708
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96C23
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GALM, also named as Aldose 1-epimerase, belongs to the aldose epimerase family. GALM is a mutarotase that catalyzes the interconversion of beta-D-galactose and alpha-D-galactose during galactose metabolism. GALM is involved in the maintenance of the equilibrium between the beta- and alpha- anomers of galactose, therefore ensuring a sufficient supply of the alpha-anomer for GALK1. Galm is also active on D-glucose, but its preference for galactose is higher than that of glucose. The calculated molecular weight of GALM is 38 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Genet Med; Biallelic GALM pathogenic variants cause a novel type of galactosemia.; Authors - Yoichi Wada
human	WB,IHC	Front Cell Dev Biol; Comprehensive Analyses of Glucose Metabolism in Glioma Reveal the Glioma-Promoting Effect of GALM.; Authors - Jiacheng Xu ; KD Validated