GALNT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GALNT2 Polyclonal antibody, PBS Only (17441-1-PBS)

• 

  WB analysis using 17441-1-AP (same clone as 17441-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17441-1-AP (GALNT2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 17441-1-AP (same clone as 17441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 17441-1-AP (GALNT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17441-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 17441-1-AP (same clone as 17441-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 17441-1-AP (GALNT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17441-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17441-1-AP (same clone as 17441-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GALNT2 antibody (17441-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17441-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17441-1-AP (same clone as 17441-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GALNT2 antibody (17441-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17441-1-PBS in a different storage buffer formulation.

GALNT2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 17441-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

pp GaNTase 2, Polypeptide N-acetylgalactosaminyltransferase 2 soluble form, Polypeptide N-acetylgalactosaminyltransferase 2, GalNAc-T2, GalNAc T2

---

Product Information

17441-1-PBS targets GALNT2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11523

  Product name: Recombinant human GALNT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 222-571 aa of BC041120

  Sequence: FLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ

• Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2)
• Calculated Molecular Weight: 571 aa, 65 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC041120
• Gene Symbol: GALNT2
• Gene ID (NCBI): 2590
• RRID: AB_3085523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q10471
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GALNT2, a GalNAc-transferase involved in O-linked glycosylation, modulates the risk of atherogenic dyslipidemia, a specific hallmark of insulin resistance and acts as a positive modulator of insulin signaling in human liver cells by down-regulating ENPP1. GALNT2 gene encodes GalNAc-T2 as a regulator of high-density lipoprotein cholesterol (HDL-C) metabolism (PMID: 31040393, 27508872). Western blot analysis detected GALNT2 at an apparent molecular mass of 64 kDa.