GAMT Monoclonal antibody

• 

  WB analysis of fetal human brain using 66322-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66322-1-Ig (GAMT Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 66322-1-Ig

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 66322-1-Ig (GAMT Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 66322-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66322-1-Ig (GAMT Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig liver using 66322-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66322-1-Ig (GAMT Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

GAMT Monoclonal Antibody for WB, ELISA

Cat No. 66322-1-Ig

Clone No.1E7B11

Publications(4)

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, mouse, pig

Applications

WB, ELISA

Synonyms

GAMT, PIG2, TP53I2

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, mouse liver tissue, pig liver tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below

Product Information

66322-1-Ig targets GAMT in WB, ELISA applications and shows reactivity with human, rat, mouse, pig samples.

• Tested Reactivity: human, rat, mouse, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16778

  Product name: Recombinant human GAMT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-236 aa of BC016760

  Sequence: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG

• Full Name: guanidinoacetate N-methyltransferase
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC016760
• Gene Symbol: GAMT
• Gene ID (NCBI): 2593
• RRID: AB_2881702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14353
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GAMT converts the latter to creatine with S-adenosylmethionine as the methyl donor. GAMT was induced in human and mouse cells in response to genotoxic and metabolic stress. GAMT was required for p53-dependent upregulation of creatine biosynthesis, fatty acid oxidation, and apoptosis in response to glucose deprivation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Food Funct; The protective effect of polyunsaturated fatty acid intake during pregnancy against embryotoxicity of sodium valproate in mice; Authors - Kelei Li
human	WB	BMC Cardiovasc Disord; PMID: 31888640; Authors - Zhuyin Jia
human	WB	Sci Rep; Identification of disulfidptosis-related subtypes in gastric cancer and GAMT is a key gene during disulfidptosis; Authors - Wenxue Wu ; KD Validated
mouse	WB	Sci Rep; Intratesticular creatine maintains spermatogenesis by defining tight junctions; Authors - Sohei Kuribayashi ; KO Validated