GAMT Monoclonal antibody, PBS Only (Detector)

GAMT Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 66322-1-PBS
Clone No.1E7B11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

1E7B11, EC:2.1.1.2, guanidinoacetate N methyltransferase, Guanidinoacetate N-methyltransferase, PIG2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66322-1-PBS targets GAMT as part of a matched antibody pair:

MP51460-1: 66322-2-PBS capture and 66322-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16778

Product name: Recombinant human GAMT protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-236 aa of BC016760

Sequence: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG

Predict reactive species
Full Name guanidinoacetate N-methyltransferase
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC016760
Gene Symbol GAMT
Gene ID (NCBI) 2593
RRIDAB_2881702
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14353
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GAMT converts the latter to creatine with S-adenosylmethionine as the methyl donor. GAMT was induced in human and mouse cells in response to genotoxic and metabolic stress. GAMT was required for p53-dependent upregulation of creatine biosynthesis, fatty acid oxidation, and apoptosis in response to glucose deprivation.

Loading...
||
New chat Able
正在加载,请稍候...