GARNL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GARNL1 Polyclonal antibody, PBS Only (29847-1-PBS)

• 

  WB analysis using 29847-1-AP (same clone as 29847-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29847-1-AP (GARNL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29847-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 29847-1-AP (same clone as 29847-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using GARNL1 antibody (29847-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 29847-1-PBS in a different storage buffer formulation.

GARNL1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 29847-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

29847-1-PBS targets GARNL1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31518

  Product name: Recombinant human GARNL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 680-820 aa of NM_014990.3

  Sequence: LDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGWSRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRSTRVRHFSQSEETGNEVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSQK

• Full Name: GTPase activating Rap/RanGAP domain-like 1
• Calculated Molecular Weight: 230KD
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: NM_014990.3
• Gene Symbol: GARNL1
• Gene ID (NCBI): 253959
• RRID: AB_3086178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6GYQ0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GARNL1/RalGAPα1, a major α subunit of the Ral-GTPase activating protein in skeletal muscle, as a protein whose phosphorylation and binding to the regulatory 14-3-3 proteins is stimulated by insulin and also by muscle contraction (PMID:24768767).The 100 kDa band maybe an isoform or fragment (BAA74907, 943aa).