• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated GATA2 Polyclonal antibody

GATA2 Polyclonal Antibody for IF
Cat No. CL488-11103

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF

FLJ45948, GATA binding protein 2, GATA2, NFE1B

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11103 targets GATA2 in IF applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1557

Product name: Recombinant human GATA2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 168-467 aa of BC018988

Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

Predict reactive species
Full Name GATA binding protein 2
Observed Molecular Weight50-60 kDa
GenBank Accession NumberBC018988
Gene Symbol GATA2
Gene ID (NCBI) 2624
ENSEMBL Gene IDENSG00000179348
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP23769
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

What is the molecular weight of GATA2? Is GATA2 post-translationally modified?

The molecular weight of GATA2 is 51 kDa. There are two known isoforms of GATA2 that use alternative first exons (PMID: 10731672). GATA2 can be phosphorylated, which regulates its activity (PMID: 7876160).

 What is the subcellular localization of GATA2?

GATA2 acts as a transcription factor in the nucleus. However, it can also be found in the cytoplasm (PMID: 25163535) and its phosphorylation promotes nuclear localization (PMID: 15837948).

 What is the tissue expression pattern of GATA2?

GATA2 was initially identified as a hematopoietic transcription factor regulating the differentiation of hematopoietic stem cells but is also present in early erythroid cells, mast cells, and megakaryocytes. Additionally, it is expressed in the central nervous system (PMID: 10357893).



Loading...
||
New chat Able
正在加载,请稍候...