GATA3 Recombinant monoclonal antibody, PBS Only (Capture)

GATA3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83808-1-PBS
Clone No.240684A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

240684A2, GATA binding factor 3, GATA-binding factor 3, Trans-acting T-cell-specific transcription factor GATA-3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83808-1-PBS targets GATA3 as part of a matched antibody pair:

MP01933-1: 83808-1-PBS capture and 83808-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0174

Product name: Recombinant human GATA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 224-442 aa of BC003070

Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM

Predict reactive species
Full Name GATA binding protein 3
Calculated Molecular Weight 443 aa, 48 kDa
Observed Molecular Weight 37 kDa and 48 kDa
GenBank Accession NumberBC003070
Gene Symbol GATA3
Gene ID (NCBI) 2625
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP23771
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Trans-acting T-cell-specific transcription factor, also known as GATA3, belongs to the zinc-finger transcription factor GATA family which drives the differentiation of T helper (Th) 2 cells. GATA factors are expressed in a tissue-specific manner and GATA3 is present in both hematopoietic (e.g., T cells) and non-hematopoietic tissues, including the kidney, central nervous system, skin, and mammary gland (PMID: 25148023). GATA3 plays a central role in Th2 responses both in vitro and in vivo (PMID: 16467870). The full-length GATA3 protein contains 444 aa corresponding to the molecular weights of 48 kDa, and the truncated protein was detected at approximately 37 kDa (PMID: 24758297).

Loading...
||
New chat

Able

正在加载,请稍候...