GATD3 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GATD3 Recombinant monoclonal antibody (88088-1-RR)

• 

  WB analysis using 88088-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88088-1-RR (C21orf33 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

GATD3 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88088-1-RR

Clone No.260353D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

GAL3A, GATD3A, Glutamine amidotransferase-like class 1 domain-containing protein 3, mitochondrial

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, THP-1 cells, A549 cells, mouse liver tissue, rat skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88088-1-RR targets GATD3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag37527

  Product name: Recombinant human C21orf33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-268 aa of BC002370

  Sequence: AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK

• Full Name: chromosome 21 open reading frame 33
• Calculated Molecular Weight: 268 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC002370
• Gene Symbol: C21orf33
• Gene ID (NCBI): 8209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P0DPI2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATD3A is a member of glutamine amidotransferase-like class 1 domain-containing (GATD) family. GATD proteins classically generate ammonia by amidolysis from the glutamine amide nitrogen, transferring it to an acceptor substrate in a variety of anabolic reactions involving purine and pyrimidine synthesis (PMID: 9575335). GATD3A restricts the formation of AGEs in mitochondria and is a relevant target for diseases where AGE deposition is a pathological hallmark (PMID: 35307029).