GATM Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GATM Polyclonal antibody (12801-1-AP)

GATM Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12801-1-AP Copied!

Publications (20)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

AGAT, AT, GATM, Transamidinase

• 

  WB analysis of mouse kidney using 12801-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat kidney using 12801-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat pancreas using 12801-1-AP

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 12801-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12801-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12801-1-AP (GATM antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GATM in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, human kidney tissue, rat kidney tissue, rat pancreas tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12801-1-AP targets GATM in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3754

  Product name: Recombinant human GATM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 74-423 aa of BC004141

  Sequence: PLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD

• Full Name: glycine amidinotransferase (L-arginine:glycine amidinotransferase)
• Calculated Molecular Weight: 423 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC004141
• Gene Symbol: GATM
• Gene ID (NCBI): 2628
• RRID: AB_2109060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50440
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATM, also known as AGAT, produces ornithine and guanidinoacetate (GAA) from arginine and glycine, and is a key enzyme for creatine synthesis. GATM deficiency in early infancy causes neurodevelopmental delay. GATM is predominantly expressed in kidney and pancreas in adults. Decrease of GAMT proteins was observed in proximal tubule damage cases, which links GATM as a general marker for proximal tubule damage. Alternative splicing of GATM generates three isoforms with molecular weights between 44 kDa to 48 kDa.

Publications

What published studies show

The GATM Polyclonal antibody (Cat# 12801-1-AP) has 20 citations across 19 journals, including Nature, Cell Metab, Nat Commun, Sci Adv, and Acta Pharm Sin B. Research fields span ferroptosis, glioblastoma, arginine/creatine metabolism, acute myeloid leukemia, kidney injury, ovarian and cervical cancer, cholangiocarcinoma, cardioprotection, thermogenesis, macrophage polarization, thrombophilia, Fanconi syndrome, and tumor metastasis. Applications cited include WB, IHC, IF, and Indirect ELISA in human, mouse, and rat samples.

Automatically generated from the 20 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Spermine is an endogenous iron chelator that inhibits ferroptosis; Authors - Man Li
mouse,human	WB,IF	Cell Metab; Myeloid cell-derived creatine in the hypoxic niche promotes glioblastoma growth; Authors - Aida Rashidi
human	WB	Cell Metab; Lighting up arginine metabolism reveals its functional diversity in physiology and pathology; Authors - Rui Li
mouse	IHC	Acta Pharm Sin B; Spatial metabolomics highlights metabolic reprogramming in acute myeloid leukemia mice through creatine pathway; Authors - Yucheng Bao
mouse	IF	Sci Adv; Glioblastoma exploits ATP from leading-edge astrocytes to fuel its infiltrative growth revealed by spatially resolved chimeric analysis; Authors - Gaoxia Yang
	WB,IHC,IF	Int J Biol Macromol; Role of GATM/creatine as energy reserves in the poll gland and rutting activities in male Bactrian camel; Authors - Zhixiong Tang