GATM Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GATM Polyclonal antibody, PBS Only (12801-1-PBS)

• 

  WB analysis of mouse kidney using 12801-1-AP (same clone as 12801-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12801-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 12801-1-AP (same clone as 12801-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12801-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat pancreas using 12801-1-AP (same clone as 12801-1-PBS)

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12801-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 12801-1-AP (same clone as 12801-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 12801-1-AP (GATM antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12801-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12801-1-AP (same clone as 12801-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12801-1-AP (GATM antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12801-1-PBS in a different storage buffer formulation.

GATM Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12801-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12801-1-PBS targets GATM in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3754

  Product name: Recombinant human GATM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 74-423 aa of BC004141

  Sequence: PLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD

• Full Name: glycine amidinotransferase (L-arginine:glycine amidinotransferase)
• Calculated Molecular Weight: 423 aa, 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC004141
• Gene Symbol: GATM
• Gene ID (NCBI): 2628
• RRID: AB_2109060
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50440
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GATM, also known as AGAT, produces ornithine and guanidinoacetate (GAA) from arginine and glycine, and is a key enzyme for creatine synthesis. GATM deficiency in early infancy causes neurodevelopmental delay. GATM is predominantly expressed in kidney and pancreas in adults. Decrease of GAMT proteins was observed in proximal tubule damage cases, which links GATM as a general marker for proximal tubule damage. Alternative splicing of GATM generates three isoforms with molecular weights between 44 kDa to 48 kDa.