GATSL2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GATSL2 Polyclonal antibody, PBS Only (22843-1-PBS)

• 

  WB analysis of rat brain using 22843-1-AP (same clone as 22843-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 22843-1-AP (GATSL2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22843-1-PBS in a different storage buffer formulation.

GATSL2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22843-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

22843-1-PBS targets GATSL2 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18791

  Product name: Recombinant human GATSL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 137-257 aa of BC147030

  Sequence: HTLSSEFTILRVVNGETVAAENLGITNGFVKPKLVQRPVIHPLSSPSNRFCVTSLDPDTLPAVATLLMDVMFYSNGVKDPMATGDDCGHIRFFSFSLIEGYISLVMDVQTQQRFPSNLLFT

• Full Name: GATS-like protein 2
• Calculated Molecular Weight: 329 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC147030
• Gene Symbol: GATSL2
• Gene ID (NCBI): 729438
• RRID: AB_3085703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: A6NHX0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GATSL2,also named CASTOR2, lacks an arginine-binding capacity and is constitutively associated with GATOR2 complex, resulting in persistent mTORC1 inactivation.