GBA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GBA Polyclonal antibody, PBS Only (27972-1-PBS)

• 

  WB analysis using 27972-1-AP (same clone as 27972-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27972-1-AP (GBA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27972-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 27972-1-AP (same clone as 27972-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 27972-1-AP (GBA antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27972-1-AP (same clone as 27972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27972-1-AP (same clone as 27972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 27972-1-AP (same clone as 27972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 27972-1-AP (same clone as 27972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27972-1-PBS in a different storage buffer formulation.

GBA Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27972-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

GBA1, Cholesteryl-beta-glucosidase, Cholesterol glucosyltransferase, Beta-glucosylceramidase 1, Beta-glucocerebrosidase

---

Product Information

27972-1-PBS targets GBA in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27388

  Product name: Recombinant human GBA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 75-305 aa of BC003356

  Sequence: TFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRDFIARDLGP

• Full Name: glucosidase, beta; acid (includes glucosylceramidase)
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC003356
• Gene Symbol: GBA
• Gene ID (NCBI): 2629
• RRID: AB_2881024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04062
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.