GBAS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GBAS Polyclonal antibody, PBS Only (18570-1-PBS)

• 

  WB analysis using 18570-1-AP (same clone as 18570-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18570-1-AP (GBAS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18570-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18570-1-AP (same clone as 18570-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18570-1-AP (GBAS antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18570-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 18570-1-AP (same clone as 18570-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18570-1-AP (GBAS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18570-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18570-1-AP (same clone as 18570-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18570-1-AP (GBAS Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18570-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18570-1-AP (same clone as 18570-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18570-1-AP (GBAS Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18570-1-PBS in a different storage buffer formulation.

GBAS Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18570-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

18570-1-PBS targets GBAS in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13405

  Product name: Recombinant human GBAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-286 aa of BC030821

  Sequence: MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ

• Full Name: glioblastoma amplified sequence
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC030821
• Gene Symbol: GBAS
• Gene ID (NCBI): 2631
• RRID: AB_2878553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75323
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.