GBE1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85143-5-RR (same clone as 85143-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85143-5-RR (GBE1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85143-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 85143-5-RR (same clone as 85143-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85143-5-RR (GBE1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85143-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85143-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85143-5-RR against Human GBE1 were performed. The affinity constant is below 1 pM.

GBE1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85143-5-PBS

Clone No.242705G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

1,4-alpha-glucan-branching enzyme, 242705G3, APBD, EC:2.4.1.18, GBE

---

Product Information

85143-5-PBS targets GBE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14154

  Product name: Recombinant human GBE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-302 aa of BC012098

  Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNM

• Full Name: glucan (1,4-alpha-), branching enzyme 1
• Calculated Molecular Weight: 702 aa, 80 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC012098
• Gene Symbol: GBE1
• Gene ID (NCBI): 2632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04446
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GBE1 (glucan (1,4-alpha-), branching enzyme 1) is essential for the globular and branched structure of glycogen, increasing solubility by creating a hydrophilic surface and reducing intracellular osmotic pressure. It may serve as a potential therapeutic target for treating LUAD(PMID: 31221150). The full sequence can be further processed into a mature form of 75 kDa.