GBGT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GBGT1 Polyclonal antibody, PBS Only (32983-1-PBS)

• 

  WB analysis using 32983-1-AP (same clone as 32983-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32983-1-AP (GBGT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32983-1-PBS in a different storage buffer formulation.

GBGT1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32983-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Forssman glycolipid synthase-like protein, Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1, UNQ2513/PRO6002

---

Product Information

32983-1-PBS targets GBGT1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38506

  Product name: Recombinant human GBGT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 185-347 aa of NM_021996.5

  Sequence: ETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS

• Full Name: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
• Calculated Molecular Weight: 40kDa，347aa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_021996.5
• Gene Symbol: GBGT1
• Gene ID (NCBI): 26301
• RRID: AB_3742812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5D6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GBGT1 (Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1) gene is located on chromosome 9 (9q34) and comprises 347 amino acids. GBGT1 is the most differentially expressed glycogene involved in the biosynthesis of Fs antigen and GBGT1 is differentially methylated and associated with inflammatory bowel disease (PMID: 25294702). GBGT1 mRNA expression has been observed in a variety of human tissues being highest in placenta and ovary (PMID: 31933576).