GBP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GBP2 Polyclonal antibody (27299-1-AP)

• Featured Product
• KD/KO Validated

GBP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27299-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GBP 2, GBP2, GTP binding protein 2, HuGBP 2

• 

  WB analysis using 27299-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27299-1-AP (GBP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 27299-1-AP

  WB result of GBP2 antibody (27299-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GBP2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 27299-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 27299-1-AP (GBP2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 27299-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 27299-1-AP (GBP2 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 27299-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 27299-1-AP (GBP2 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GBP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A375 cells, HeLa cells, mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27299-1-AP targets GBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25433

  Product name: Recombinant human GBP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 435-481 aa of BC022272

  Sequence: TQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLS

• Full Name: guanylate binding protein 2, interferon-inducible
• Calculated Molecular Weight: 591 aa, 67 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC022272
• Gene Symbol: GBP2
• Gene ID (NCBI): 2634
• RRID: AB_2880836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P32456
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GBP2 Polyclonal antibody (Cat# 27299-1-AP) has 10 citations. These appear in journals including Nature Communications, Advanced Science, EMBO Journal, Cancer Science, Oncology Reports, Journal of Immunology, Microvascular Research, PLoS One, Anticancer Research, and Journal of Translational Medicine. Research fields span cancer biology (melanoma, ovarian, renal, pancreatic cancers), immunotherapy, inflammation, pyroptosis, ferroptosis, angiogenesis, lupus nephritis, and bacterial infection responses. Applications cited include WB and IHC in human and mouse samples.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nat Commun; GBP2 condensates promote ferroptosis to sensitize anti-PD-L1 immunotherapy in melanoma.; Authors - Xin Liu
mouse	WB,IHC	Adv Sci (Weinh); CpG-Based Nanovaccines Enhance Ovarian Cancer Immune Response by Gbp2-Mediated Remodeling of Tumor-Associated Macrophages; Authors - Jiaqiang Xiong
		EMBO J; GBP1 recruitment to actin-rich pedestals of extracellular Gram-negative bacteria promotes pyroptosis.; Authors - Daniel J Bennison
human	WB,IHC	Cancer Sci; Crosstalk between GBP2 and M2 macrophage promotes the ccRCC progression; Authors - Wei Zheng ; KO Validated
human	WB,IHC	Oncol Rep; GBP2 promotes clear cell renal cell carcinoma progression through immune infiltration and regulation of PD‑L1 expression via STAT1 signaling; Authors - Shujiang Ye
mouse	WB	J Immunol; IRF8 Regulates Gram-Negative Bacteria-Mediated NLRP3 Inflammasome Activation and Cell Death.; Authors - Rajendra Karki