GCM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GCM1 Polyclonal antibody (21724-1-AP)

GCM1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21724-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

Chorion-specific transcription factor GCMa, GCM motif protein 1, GCMA, Glial cells missing homolog 1, hGCMa

• 

  WB analysis of HepG2 using 21724-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21724-1-AP (GCM1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 21724-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21724-1-AP (GCM1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 21724-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 21724-1-AP (GCM1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GCM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21724-1-AP targets GCM1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16383

  Product name: Recombinant human GCM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-436 aa of BC096288

  Sequence: SVSLSLKGSTETRSLPGETQSQGSLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPMKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQAWSKNAALGRNHLADNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQLPLEPPAAKTGCPPLWPNPAGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNNDMLLNLCPLR

• Full Name: glial cells missing homolog 1 (Drosophila)
• Calculated Molecular Weight: 436 aa, 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC096288
• Gene Symbol: GCM1
• Gene ID (NCBI): 8521
• RRID: AB_2878913
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP62
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GCM1 Polyclonal antibody (Cat# 21724-1-AP) has 6 total citations. These appear in journals including Nucleic Acids Research, BMC Medicine, Environmental Pollution, Reproductive Biology and Endocrinology, Frontiers in Cell and Developmental Biology, and Placenta. The research fields span trophoblast syncytialization, placental development, preeclampsia, epigenetic regulation of fetoplacental growth, and environmental impacts on pregnancy outcomes.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; Reduced FBXO22 skews human trophoblast fate equilibrium toward syncytialization via polyubiquitinating the CoREST complex.; Authors - Hongli Li
human	WB	BMC Med; Epigenetic drug screening for trophoblast syncytialization reveals a novel role for MLL1 in regulating fetoplacental growth; Authors - Jiayi Wu
mouse	WB	Environ Pollut; Gestational exposure to micro- and nanoplastics leads to poor pregnancy outcomes by impairing placental trophoblast syncytialization; Authors - Yanmin Cheng
human	WB	Reprod Biol Endocrinol; Alpha-actinin-4 is essential for maintaining normal trophoblast proliferation and differentiation during early pregnancy.; Authors - Wei Peng
human	WB,IHC	Front Cell Dev Biol; Reduced Wiskott-Aldrich syndrome protein expression in preeclampsia placenta impairs trophoblast syncytialization by modulating syncytin-2 via FAK/β-catenin pathway.; Authors - Shuo Zhang
		Placenta; SIGLEC6 impairs trophoblast function and orchestrates macrophage M1 polarization via suppression of Akt signaling in early-onset preeclampsia.; Authors - Xinyue Tong