Use Able AI chat for product recommendations

GCN1 Polyclonal antibody, PBS Only

GCN1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30993-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

GCN1L1, GCN1L, HsGCN1, KIAA0219, PRIC295

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30993-1-PBS targets GCN1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag34311

Product name: Recombinant human GCN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 624-745 aa of BC153881

Sequence: EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLIST

Predict reactive species
Full Name GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
Calculated Molecular Weight293 kDa
Observed Molecular Weight250 kDa
GenBank Accession NumberBC153881
Gene Symbol GCN1L1
Gene ID (NCBI) 10985
RRIDAB_3742385
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ92616
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GCN1 (General Control Nonderepressible 1), also designated as GCN1L1, is a member of the GCN1 protein family. Its core function is to serve as a central regulator of the integrated stress response (ISR), acting as a key molecular adaptor that facilitates the activation of GCN2 kinase. Under stress conditions such as amino acid starvation, GCN1 binds uncharged tRNA through its C-terminal domain while concurrently binding and activating GCN2 via its N-terminal domain. This leads to the phosphorylation of eIF2α, thereby initiating the ISR to modulate translation and gene expression. Furthermore, GCN1 participates in ribosome-associated quality control (RQC). In coordination with the RQT complex, it mediates the ubiquitination and subsequent degradation of aberrant nascent polypeptide chains on stalled ribosomes, thus preserving protein homeostasis.

Loading...
||
New chat

Able

正在加载,请稍候...