GCNT2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GCNT2 Polyclonal antibody, PBS Only (18118-1-PBS)

• 

  WB analysis of mouse kidney using 18118-1-AP (same clone as 18118-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 18118-1-AP (GCNT2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 18118-1-AP (same clone as 18118-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 18118-1-AP (GCNT2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 18118-1-AP (same clone as 18118-1-PBS)

  N/A This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 18118-1-AP (same clone as 18118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 18118-1-AP (GCNT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18118-1-AP (same clone as 18118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18118-1-AP (GCNT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 18118-1-AP (same clone as 18118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 18118-1-AP (GCNT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 18118-1-AP (same clone as 18118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 18118-1-AP (GCNT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 18118-1-AP (same clone as 18118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 18118-1-AP (GCNT2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 18118-1-AP (same clone as 18118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon using 18118-1-AP (GCNT2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 18118-1-PBS in a different storage buffer formulation.

GCNT2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 18118-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CCAT, EC:2.4.1.150, GCNT2C, GCNT5, I-branching enzyme

---

Product Information

18118-1-PBS targets GCNT2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12635

  Product name: Recombinant human GCNT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 29-400 aa of BC074801

  Sequence: GDPSFQRLNISDPLRLTQVCTSFINGKTRFLWKNKLMIHEKSSCKEYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSCFPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF

• Full Name: glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group)
• Calculated Molecular Weight: 400 aa, 46 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC074801
• Gene Symbol: GCNT2
• Gene ID (NCBI): 2651
• RRID: AB_2232115
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N0V5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GCNT2 (N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase) catalyzes the transfer of N-acetylglucosamine to the carbon-6 position of galactose. The loss of GCNT2 expression and corresponding loss of I-antigen in melanoma cells has profound effects on key oncogenic signaling pathways, including integrin-mediated signaling pathways critical for metastasis (PMID: 33660254, 30135430). Alterations in GCNT2 expression have now been associated with multiple malignancies, with high GCNT2 promoting tumor progression in a majority of investigated cancers. Three GCNT2 splicing variants GCNT2A, -B, and -C, which differ at exon 1 but have identical exon 2 and 3 coding regions, are expressed differentially in specific tissues (PMID: 15161861). GCNT2C determines the expression of the blood group I antigen in erythrocytes.