GDF11 Polyclonal antibody

• 

  WB analysis using 26715-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 26715-1-AP (GDF11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 26715-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26715-1-AP (GDF11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 26715-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26715-1-AP (GDF11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HeLa using 26715-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.2 ug Anti-Human GDF11 (26715-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

GDF11 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 26715-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

BMP 11, BMP11, Bone morphogenetic protein 11, GDF 11

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

26715-1-AP targets GDF11 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25107

  Product name: Recombinant human GDF11 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 299-407 aa of NM_005811

  Sequence: NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

• Full Name: growth differentiation factor 11
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_005811
• Gene Symbol: GDF11
• Gene ID (NCBI): 10220
• RRID: AB_2918107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95390
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Placenta; Follistatin dysregulation impaired trophoblast biological functions by GDF11-Smad2/3 axis in preeclampsia placentas.; Authors - Hui Li
mouse	WB	Int J Chron Obstruct Pulmon Dis; Therapeutic Effects of Lifei Decoction in a Murine Model of COPD Induced by LPS and Cigarette Smoke; Authors - Liguo Lu
mouse,human	WB	J Pharm Anal; Hapln1 promotes dedifferentiation and proliferation of iPSC-derived cardiomyocytes by promoting versican-based GDF11 trapping; Authors - Ding-Jun Hao
mouse	WB	Mol Neurobiol; GDF11 Regulates M1 and M2 Polarization of BV2 Microglial Cells via p38 MAPK Signaling Pathway; Authors - Xiangyu Zhao ; KD Validated
human	WB	Front Oncol; Exosome-transmitted miR-3124-5p promotes cholangiocarcinoma development via targeting GDF11; Authors - Huijie Gao