Home
Products
Primary Antibodies
GDF11 Polyclonal antibody, PBS Only (26715-1-PBS)

Filter: AllWBIHCFC (Intra)

WB analysis using 26715-1-AP (same clone as 26715-1-PBS)
K-562 cells were subjected to SDS PAGE followed by western blot with 26715-1-AP (GDF11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26715-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 26715-1-AP (same clone as 26715-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26715-1-AP (GDF11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26715-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 26715-1-AP (same clone as 26715-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 26715-1-AP (GDF11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26715-1-PBS in a different storage buffer formulation.
FC experiment of HeLa using 26715-1-AP (same clone as 26715-1-PBS)
1X10^6 HeLa cells were intracellularly stained with 0.2 ug Anti-Human GDF11 (26715-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 26715-1-PBS in a different storage buffer formulation.
×
1X10^6 HeLa cells were intracellularly stained with 0.2 ug Anti-Human GDF11 (26715-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 26715-1-PBS in a different storage buffer formulation.

GDF11 Polyclonal antibody, PBS Only

Name: GDF11 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 26715-1-PBS

GDF11 Polyclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 26715-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

BMP 11, BMP11, Bone morphogenetic protein 11, GDF 11

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

26715-1-PBS targets GDF11 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag25107 Product name: Recombinant human GDF11 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 299-407 aa of NM_005811 Sequence: NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS Predict reactive species
Full Name	growth differentiation factor 11
Calculated Molecular Weight	45 kDa
Observed Molecular Weight	45 kDa
GenBank Accession Number	NM_005811
Gene Symbol	GDF11
Gene ID (NCBI)	10220
RRID	AB_2918107
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O95390
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.