GDF6/BMP-13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GDF6/BMP-13 Polyclonal antibody (33521-1-AP)

• 

  WB analysis using 33521-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33521-1-AP (GDF6/BMP-13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GDF6/BMP-13 Polyclonal Antibody for WB, ELISA

Cat No. 33521-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GDF6, BMP13, CDMP2, GDF 6, GDF16

---

Tested Applications

• Positive WB detected in: HUVEC cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33521-1-AP targets GDF6/BMP-13 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40394

  Product name: Recombinant human BMP-13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 336-455 aa of NM_001001557

  Sequence: TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR

• Full Name: growth differentiation factor 6
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: NM_001001557
• Gene Symbol: GDF6
• Gene ID (NCBI): 392255
• RRID: AB_3743000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6KF10
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GDF6, also known as BMP-13, is a member of the transforming growth factor-beta superfamily. GDF6 is a multifunctional growth factor that mainly functions in cells derived from the mesoderm. It can regulate the proliferation and differentiation of the retina and bones(PMID: 23307924). Mutations in GDF6 are associated with Klippel-Feil syndrome(PMID: 18425797).