GDI2 Monoclonal antibody, PBS Only

• 

  WB analysis using 60078-1-Ig (same clone as 60078-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60078-1-Ig (GDI2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 60078-1-Ig (same clone as 60078-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 60078-1-Ig (GDI2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60078-1-Ig (same clone as 60078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60078-1-Ig (GDI2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60078-1-Ig (same clone as 60078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60078-1-Ig (GDI2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 60078-1-Ig (same clone as 60078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60078-1-Ig (GDI2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 60078-1-Ig (same clone as 60078-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60078-1-Ig (GDI2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60078-1-Ig (same clone as 60078-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 60078-1-Ig (GDI2 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60078-1-Ig (same clone as 60078-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using GDI2 antibody (60078-1-Ig, Clone: 4B8F3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60078-1-Ig (same clone as 60078-1-PBS)

  Immunofluorescent analysis of Hela cells, using GDI2 antibody 60078-1-Ig at 1:25 dilution and Rhodamine-labeled goat anti-mouse IgG (red). This data was developed using the same antibody clone with 60078-1-PBS in a different storage buffer formulation.

GDI2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60078-1-PBS

Clone No.4B8F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

4B8F3, GDI 2, GDI-2, GDP dissociation inhibitor 2, Rab GDI beta

---

Product Information

60078-1-PBS targets GDI2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4613

  Product name: Recombinant human GDI2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-234 aa of BC005145

  Sequence: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGEL

• Full Name: GDP dissociation inhibitor 2
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC005145
• Gene Symbol: GDI2
• Gene ID (NCBI): 2665
• RRID: AB_2232457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P50395
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI2 distributes ubiquitously, displaying a membrane bound location in perinuclear regions of cells. GDI-2 was thought to be involved in cellular response to insulin. It electrophoreses as a 46kd protein in SDS-PAGE. (PMID: 7929030; PMID: 19570034). This antibody can bind both GDIs for the close sequences.