Use Able AI chat for product recommendations
  • KD/KO Validated

GDI2 Monoclonal antibody

GDI2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60078-1-Ig
Clone No. 4B8F3
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

4B8F3, GDI 2, GDI-2, GDP dissociation inhibitor 2, Rab GDI beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GDI2 in ?

Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman breast cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60078-1-Ig targets GDI2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4613

Product name: Recombinant human GDI2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-234 aa of BC005145

Sequence: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGEL

Predict reactive species
Full Name GDP dissociation inhibitor 2
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC005145
Gene Symbol GDI2
Gene ID (NCBI) 2665
RRIDAB_2232457
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP50395
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI2 distributes ubiquitously, displaying a membrane bound location in perinuclear regions of cells. GDI-2 was thought to be involved in cellular response to insulin. It electrophoreses as a 46kd protein in SDS-PAGE. (PMID: 7929030; PMID: 19570034). This antibody can bind both GDIs for the close sequences.

Protocols

Product Specific Protocols
IF protocol for GDI2 antibody 60078-1-IgDownload protocol
IHC protocol for GDI2 antibody 60078-1-IgDownload protocol
WB protocol for GDI2 antibody 60078-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The GDI2 Monoclonal antibody (4B8F3), catalog number 60078-1-Ig, has a total of 1 citation. The citation appears in J Cancer (2024), a study examining vesicle-mediated transport-related genes in hepatocellular carcinoma prognosis and immune microenvironment. The research field is cancer biology, specifically hepatocellular carcinoma. The antibody was applied in WB and IHC on human samples.

SpeciesApplicationTitle
humanWB,IHC

J Cancer

Vesicle-mediated transport-related genes predict the prognosis and immune microenvironment in hepatocellular carcinoma

Authors - Zhiyue Ye
Loading...
||
New chat

Able™

正在加载,请稍候...