CoraLite® Plus 647-conjugated GDI2 Monoclonal antibody

GDI2 Monoclonal Antibody for IF/ICC
Cat No. CL647-60078
Clone No.4B8F3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

IF/ICC

FLJ16452, FLJ37352, GDI 2, GDI2, GDP dissociation inhibitor 2, Rab GDI beta, RABGDIB

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-60078 targets GDI2 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4613

Product name: Recombinant human GDI2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-234 aa of BC005145

Sequence: MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGEL

Predict reactive species
Full Name GDP dissociation inhibitor 2
Calculated Molecular Weight 47 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC005145
Gene Symbol GDI2
Gene ID (NCBI) 2665
RRIDAB_2934976
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP50395
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GDP dissociation inhibitors (GDIs) are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, GDIs can bind and release GDP-bound Rab proteins from membranes. Two GDI proteins towards different Rab proteins have been identified. GDI1 interacts with almost all of the Rab proteins, while GDI2 interacts with Rabll but not Rab3A. GDI2 distributes ubiquitously, displaying a membrane bound location in perinuclear regions of cells. GDI-2 was thought to be involved in cellular response to insulin. It electrophoreses as a 46kd protein in SDS-PAGE. (PMID: 7929030; PMID: 19570034). This antibody can bind both GDIs for the close sequences.

Protocols

Product Specific Protocols
IF protocol for CL Plus 647 GDI2 antibody CL647-60078Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...