CoraLite® Plus 488-conjugated GDNF Recombinant monoclonal antibody

• 

  IF Staining of SH-SY5Y using CL488-83087

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CoraLite® Plus 488 GDNF antibody (CL488-83087, Clone: 230358A10 ) at dilution of 1:200.

GDNF Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83087

Clone No.230358A10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

230358A10, Astrocyte-derived trophic factor, ATF, ATF1, ATF2

---

Tested Applications

• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83087 targets GDNF in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24068

  Product name: Recombinant human GDNF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 78-211 aa of BC069369

  Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

• Full Name: glial cell derived neurotrophic factor
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 32-40 kDa
• GenBank Accession Number: BC069369
• Gene Symbol: GDNF
• Gene ID (NCBI): 2668
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P39905
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Glial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress. Protein dimers of GDNF have a reported molecular weight of 32-40 kDa(PMID: 17982417, PMID: 23251488, PMID: 11429269).