CoraLite® Plus 488-conjugated GDNF Recombinant monoclonal antibody

GDNF Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-83087
Clone No.230358A10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

230358A10, Astrocyte-derived trophic factor, ATF, ATF1, ATF2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83087 targets GDNF in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag24068

Product name: Recombinant human GDNF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 78-211 aa of BC069369

Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

Predict reactive species
Full Name glial cell derived neurotrophic factor
Calculated Molecular Weight 211 aa, 24 kDa
Observed Molecular Weight 32-40 kDa
GenBank Accession NumberBC069369
Gene Symbol GDNF
Gene ID (NCBI) 2668
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP39905
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Glial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress. Protein dimers of GDNF have a reported molecular weight of 32-40 kDa(PMID: 17982417, PMID: 23251488, PMID: 11429269).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GDNF antibody CL488-83087Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...