GEMIN6 Polyclonal antibody

GEMIN6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 12307-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Gem-associated protein 6, SIP2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

12307-2-AP targets GEMIN6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2954

Product name: Recombinant human GEMIN6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-167 aa of BC018195

Sequence: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ

Predict reactive species
Full Name gem (nuclear organelle) associated protein 6
Calculated Molecular Weight 167 aa, 19 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC018195
Gene Symbol GEMIN6
Gene ID (NCBI) 79833
RRIDAB_2111835
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WXD5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GEMIN6, also named as SIP2, is a subunit of SMN complex. It plays an important role in the splicing of cellular pre-mRNAs.

Protocols

Product Specific Protocols
IF protocol for GEMIN6 antibody 12307-2-APDownload protocol
IHC protocol for GEMIN6 antibody 12307-2-APDownload protocol
WB protocol for GEMIN6 antibody 12307-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nucleic Acids Res

SECIS-binding protein 2 interacts with the SMN complex and the methylosome for selenoprotein mRNP assembly and translation.

Authors - Anne-Sophie Gribling-Burrer
humanWB

Nucleic Acids Res

NUFIP and the HSP90/R2TP chaperone bind the SMN complex and facilitate assembly of U4-specific proteins.

Authors - Jonathan Bizarro
Loading...
||
New chat Able
正在加载,请稍候...