GEMIN6 Polyclonal antibody

• 

  WB analysis of HEK-293 using 12307-2-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12307-2-AP (GEMIN6 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 12307-2-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12307-2-AP (GEMIN6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12307-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 12307-2-AP (GEMIN6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 12307-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12307-2-AP (GEMIN6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 12307-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 12307-2-AP (GEMIN6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 12307-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using GEMIN6 antibody (12307-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

GEMIN6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12307-2-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Gem-associated protein 6, SIP2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

12307-2-AP targets GEMIN6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2954

  Product name: Recombinant human GEMIN6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC018195

  Sequence: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYDPENCSSSNEIILSRVQDLIEGHLTASQ

• Full Name: gem (nuclear organelle) associated protein 6
• Calculated Molecular Weight: 167 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC018195
• Gene Symbol: GEMIN6
• Gene ID (NCBI): 79833
• RRID: AB_2111835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXD5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GEMIN6, also named as SIP2, is a subunit of SMN complex. It plays an important role in the splicing of cellular pre-mRNAs.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nucleic Acids Res; SECIS-binding protein 2 interacts with the SMN complex and the methylosome for selenoprotein mRNP assembly and translation.; Authors - Anne-Sophie Gribling-Burrer
human	WB	Nucleic Acids Res; NUFIP and the HSP90/R2TP chaperone bind the SMN complex and facilitate assembly of U4-specific proteins.; Authors - Jonathan Bizarro