CoraLite® Plus 488-conjugated GFP tag Recombinant monoclonal antibody

GFP tag Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-81835-2
Clone No.241614B3

Host / Isotype

Rabbit / IgG

Reactivity

aequorea victoria, recombinant protein

Applications

IF/ICC

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inTransfected HEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81835-2 targets GFP tag in IF/ICC applications and shows reactivity with aequorea victoria, recombinant protein samples.

Tested Reactivity aequorea victoria, recombinant protein
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2128

Product name: Recombinant aequorea victoria GFP tag protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of M62653

Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Predict reactive species
Full Name GFP tag
Calculated Molecular Weight 26 kDa
GenBank Accession NumberM62653
Gene Symbol
Gene ID (NCBI)
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42212
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages. Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm. When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy. This antibody is generated against the full-length eGFP protein. It exhibits reactivity towards variants of Aequorea victoria GFP, including S65T-GFP, RS-GFP, YFP, CFP, and eGFP.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 GFP tag antibody CL488-81835-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...