GFRAL Polyclonal antibody

• 

  WB analysis using 28335-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28335-1-AP (GFRAL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GFRAL Polyclonal Antibody for WB, ELISA

Cat No. 28335-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

bA360D14.1, C6orf144, GRAL, UNQ9356

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28335-1-AP targets GFRAL in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28504

  Product name: Recombinant human GFRAL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 94-338 aa of NM_207410

  Sequence: MNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANK

• Full Name: GDNF family receptor alpha like
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45-60 kDa
• GenBank Accession Number: NM_207410
• Gene Symbol: GFRAL
• Gene ID (NCBI): 389400
• RRID: AB_3669653
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXV0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GFRAL (GDNF family receptor alpha-like), also called C6orf144, is the brainstem-restricted receptor for GDF15 hormone, which triggers an aversive response, characterized by nausea, vomiting, and/or loss of appetite in response to various stresses (PMID: 28846097, 28846098, 28846099, 28953886, 36630958). The GDF15-GFRAL signal induces expression of genes involved in metabolism, such as lipid metabolism in adipose tissues (PMID: 32661391). GFRAL is a single-pass membrane protein, and localizes to the plasma membrane. It is mainly expressed in the hindbrain, and its mainstream molecular weight is 45-60 kd.