GGN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GGN Polyclonal antibody, PBS Only (32984-1-PBS)

• 

  WB analysis using 32984-1-AP (same clone as 32984-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32984-1-AP (GGN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32984-1-PBS in a different storage buffer formulation.

GGN Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32984-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Gametogenetin

---

Product Information

32984-1-PBS targets GGN in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38372

  Product name: Recombinant human GGN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-381 aa of NM_152657.3

  Sequence: TESQAGPRNQGQTAGRARGGAPPHAGEGEMAQPADSESGLSLLCKITFKSRPSLAPPAASSSLAAKASLGGGGGGGLFAASGAISYAEVLKQGPLPPGAARPLGEVSRGAQEAEGGDGDGEGCSGPPSAPASQARALPPPPYTTFPGSKPKFDWVSAPDGPERHFRFNGAGGGIGAPRRRAA

• Full Name: gametogenetin
• Calculated Molecular Weight: 67kDa，652aa
• Observed Molecular Weight: 65 kDa, 70 kDa
• GenBank Accession Number: NM_152657.3
• Gene Symbol: GGN
• Gene ID (NCBI): 199720
• RRID: AB_3742813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86UU5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human gametogenetin (GGN) is expressed in the testis and ovaries and is a conserved gene in human and mouse. Recently, GGN was found to play a tumor-promoting role in cancer through regulation of NFκB/caspase-3-mediated apoptosis signaling (PMID: 30721393). GGN can be glycosylated, which may result in an increase in observed molecular weight.