GHRH Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GHRH Polyclonal antibody, PBS Only (19896-1-PBS)

• 

  IHC staining of human colon cancer using 19896-1-AP (same clone as 19896-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 19896-1-AP (GHRH antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19896-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 19896-1-AP (same clone as 19896-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 19896-1-AP (GHRH antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19896-1-PBS in a different storage buffer formulation.

GHRH Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 19896-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

GHRF, GRF, growth hormone releasing hormone

---

Product Information

19896-1-PBS targets GHRH in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13787

  Product name: Recombinant human GHRH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-108 aa of BC098161

  Sequence: PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG

• Full Name: growth hormone releasing hormone
• Calculated Molecular Weight: 108 aa, 12 kDa
• GenBank Accession Number: BC098161
• Gene Symbol: GHRH
• Gene ID (NCBI): 2691
• RRID: AB_3741971
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01286
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GHRH, also known as GHRF, belongs to the glucagon family. GHRH is a hypothalamic peptide that stimulates synthesis and proliferation of pituitary somatotroph cells as well as secretion of growth hormone. GHRH expression is predominantly in the human hypothalamus, with some expression in the basal ganglia (PMID: 39913072). Defects in GHRH are a cause of dwarfism, while hypersecretion of GHRH is a cause of gigantism.