GIMAP6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GIMAP6 Polyclonal antibody (33593-1-AP)

• 

  WB analysis using 33593-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33593-1-AP (GIMAP6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GIMAP6 Polyclonal Antibody for WB, ELISA

Cat No. 33593-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GTPase IMAP family member 6, hIAN2, hIAN6, IAN2, IAN-2

---

Tested Applications

• Positive WB detected in: HUVEC cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33593-1-AP targets GIMAP6 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38704

  Product name: Recombinant human GIMAP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 38-240 aa of NM_024711.5

  Sequence: PRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQ

• Full Name: GTPase, IMAP family member 6
• Calculated Molecular Weight: 33kDa，292aa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: NM_024711.5
• Gene Symbol: GIMAP6
• Gene ID (NCBI): 474344
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6P9H5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GTPase of immunity associated protein 6 (GIMAP6) is a member of the GIMAP family of small GTPases predominantly expressed in lymphoid tissues. GIMAP6 plays a critical role in regulating immune cell survival, particularly in T and B lymphocytes. It localizes to the endoplasmic reticulum and mitochondria, where it modulates autophagy and apoptosis pathways. Studies indicate that GIMAP6 deficiency leads to spontaneous apoptosis of lymphocytes, highlighting its essential function in maintaining immune homeostasis. Additionally, GIMAP6 has been implicated in autoimmune diseases and certain hematological malignancies, making it an emerging therapeutic target for modulating immune responses and treating lymphocyte-related disorders (PMID: 35551368; 33328581; 29718959).