CoraLite® Plus 488-conjugated GIMAP7 Monoclonal antibody

• 

  IF Staining of HepG2 using CL488-68451

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 GIMAP7 antibody (CL488-68451, Clone: 3E4A6 ) at dilution of 1:200.

GIMAP7 Monoclonal Antibody for IF/ICC

Cat No. CL488-68451

Clone No.3E4A6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Synonyms

Immunity-associated nucleotide 7 protein, IAN-7, IAN7, GTPase IMAP family member 7, 3E4A6

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-68451 targets GIMAP7 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10740

  Product name: Recombinant human GIMAP7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-300 aa of BC027613

  Sequence: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS

• Full Name: GTPase, IMAP family member 7
• Calculated Molecular Weight: 300 aa, 35 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC027613
• Gene Symbol: GIMAP7
• Gene ID (NCBI): 168537
• RRID: AB_3673019
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8NHV1
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

GIMAP7, also known as hIAN7 or IAN 7, is a transmembrane protein located in the endoplasmic reticulum and Golgi apparatus. GIMAP7 can promote oxidative stress and apoptosis in ovarian granulosa cells in Polycystic ovary syndrome by inhibiting the SHH signalling pathway(PMID: 36581994). The MW of this protein is 34 kDa, and this antibody specially recognises the 34 kDa protein.