GIYD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GIYD2 Polyclonal antibody, PBS Only (21158-1-PBS)

• 

  WB analysis of mouse brain using 21158-1-AP (same clone as 21158-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21158-1-AP (GIYD2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21158-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 21158-1-AP (same clone as 21158-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21158-1-AP (GIYD2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21158-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 21158-1-AP (same clone as 21158-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 21158-1-AP (GIYD2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21158-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GIYD2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21158-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21158-1-PBS targets GIYD2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13094

  Product name: Recombinant human GIYD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-275 aa of BC000803

  Sequence: MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQDLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET

• Full Name: GIY-YIG domain containing 2
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC000803
• Gene Symbol: GIYD2
• Gene ID (NCBI): 79008
• RRID: AB_2752255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQ83
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.