GJA5/Connexin 40 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GJA5/Connexin 40 Polyclonal antibody, PBS Only (26602-1-PBS)

• 

  IHC staining of mouse lung using 26602-1-AP (same clone as 26602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 26602-1-AP (GJA5/Connexin 40 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26602-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 26602-1-AP (same clone as 26602-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 26602-1-AP (Connexin 40 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26602-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse lung using 26602-1-AP (same clone as 26602-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse lung tissue using GJA5/Connexin 40 antibody (26602-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26602-1-PBS in a different storage buffer formulation.

GJA5/Connexin 40 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 26602-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Connexin 40, GJA5, Connexin-40, CX40, Gap junction alpha 5 protein

---

Product Information

26602-1-PBS targets GJA5/Connexin 40 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24266

  Product name: Recombinant human GJA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 233-341 aa of BC013313

  Sequence: KIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDK

• Full Name: gap junction protein, alpha 5, 40kDa
• Calculated Molecular Weight: 40 kDa
• GenBank Accession Number: BC013313
• Gene Symbol: GJA5
• Gene ID (NCBI): 2702
• RRID: AB_3669552
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36382
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Connexin 40 (Cx40), also known as Gap junction alpha 5 protein (GJA5), belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Four connexins (Cxs) are expressed in the cardiovascular system (Cx37, Cx40, Cx43, and Cx45) and are involved in the development of the cardiovascular system(PMID: 37331352; PMID: 17922338).