GLAST/EAAT1 Recombinant monoclonal antibody, PBS Only

GLAST/EAAT1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), Indirect ELISA
Cat No. 84497-4-PBS
Clone No.241907H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra), Indirect ELISA

EAAT1, GLAST, 241907H3, GLAST-1, SLC1A3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84497-4-PBS targets GLAST/EAAT1 in IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16962

Product name: Recombinant human SLC1A3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 471-542 aa of BC037310

Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM

Predict reactive species
Full Name solute carrier family 1 (glial high affinity glutamate transporter), member 3
Calculated Molecular Weight 542 aa, 60 kDa
GenBank Accession NumberBC037310
Gene Symbol GLAST
Gene ID (NCBI) 6507
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP43003
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC1A3, also known as EAAT-1 or GLAST, is a membrane-bound protein localized in glial cells and pre-synaptic glutamatergic nerve endings. It transports the excitatory neurotransmitters L-glutamate and D-aspartate, which is essential for terminating the postsynaptic acction of glutamate. Recently, a correlation between expression/function of glial EAAT-1 and tumor proliferation has been reported. The exceptionally rare expression of EAAT-1 in non-neoplastic choroid plexus (CP) compared to choroid plexus tumors (CPT) may distinguishes neoplastic from normal CP. There are a number of splicing variants of SLC1A3, like GLAST1a and GLAST1b, exist due to the exon skipping. It also undergo glycosylation. Variety of bands can be observed in the western blotting assay: 50-55 kDa represents the unglycosylated GLAST1a or GLAST1b, 65-70 kDa correspond to the glycosylated proteins, larger proteins between 90-130 kDa may be the multimers of SLC1A3. (11086157, 17471058, 12546822)

Loading...
||
New chat

Able

正在加载,请稍候...