GLAST/EAAT1 Recombinant monoclonal antibody

GLAST/EAAT1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra), ELISA
Cat No. 84497-4-RR
Clone No.241907H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra), ELISA

EAAT1, GLAST, 241907H3, GLAST-1, SLC1A3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNeuro-2a cells
Positive FC (Intra) detected inHEK-293 cells, U-937 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84497-4-RR targets GLAST/EAAT1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16962

Product name: Recombinant human SLC1A3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 471-542 aa of BC037310

Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM

Predict reactive species
Full Name solute carrier family 1 (glial high affinity glutamate transporter), member 3
Calculated Molecular Weight 542 aa, 60 kDa
GenBank Accession NumberBC037310
Gene Symbol GLAST
Gene ID (NCBI) 6507
RRIDAB_3672010
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP43003
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC1A3, also known as EAAT-1 or GLAST, is a membrane-bound protein localized in glial cells and pre-synaptic glutamatergic nerve endings. It transports the excitatory neurotransmitters L-glutamate and D-aspartate, which is essential for terminating the postsynaptic acction of glutamate. Recently, a correlation between expression/function of glial EAAT-1 and tumor proliferation has been reported. The exceptionally rare expression of EAAT-1 in non-neoplastic choroid plexus (CP) compared to choroid plexus tumors (CPT) may distinguishes neoplastic from normal CP. There are a number of splicing variants of SLC1A3, like GLAST1a and GLAST1b, exist due to the exon skipping. It also undergo glycosylation. Variety of bands can be observed in the western blotting assay: 50-55 kDa represents the unglycosylated GLAST1a or GLAST1b, 65-70 kDa correspond to the glycosylated proteins, larger proteins between 90-130 kDa may be the multimers of SLC1A3. (11086157, 17471058, 12546822)

Protocols

Product Specific Protocols
FC protocol for GLAST/EAAT1 antibody 84497-4-RRDownload protocol
IF protocol for GLAST/EAAT1 antibody 84497-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...